DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and mipa

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001003534.1 Gene:mipa / 445140 ZFINID:ZDB-GENE-040801-41 Length:263 Species:Danio rerio


Alignment Length:222 Identity:69/222 - (31%)
Similarity:102/222 - (45%) Gaps:8/222 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RQLDSITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNP 105
            |.:.....|.||...|...:|.|...::..:...::..|.|..||......||..|.:.|.|:||
Zfish     5 RSMSFWRAVFAEFYGTMFFVFFGLGAALRWTTGPHNVLQVAFCFGLAAATFIQSIGHISGGHINP 69

  Fly   106 AVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNG-VCLTSLNSTLTP 169
            |||.|..:.:.:||..|..|..||.:||..|..:|..|.|       .|..| :.|.:|...::.
Zfish    70 AVTFAYLIGSQMSLFRAFFYICAQCLGALAGAAVLYGVTP-------TNMRGNLALNTLQPGISM 127

  Fly   170 WQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPA 234
            .....:|..:|..|:.....|.|.|...:..|..:..|.::....|.....|||.|||.||||||
Zfish   128 GMATTIEIFLTLQLVVCVFAVTDERRNGRLGSAALSIGFSVLVGHLLGMYYTGAGMNPARSFAPA 192

  Fly   235 IWNGFWDDHWIYWVGPMAAALITSVIY 261
            :....:.:||:||||||..|.:.:::|
Zfish   193 VLYRNFINHWVYWVGPMIGAAMGALLY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 68/220 (31%)
mipaNP_001003534.1 MIP 3..219 CDD:278651 68/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573528
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.