DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp10a

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001002349.1 Gene:aqp10a / 436621 ZFINID:ZDB-GENE-040718-40 Length:293 Species:Danio rerio


Alignment Length:268 Identity:71/268 - (26%)
Similarity:117/268 - (43%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLAEMIATAMLMFLGCMGS--VENSVFTNSDFQSALNFGFVVLICIQCFGC--VCGAHLNPAVTL 109
            ::.|::.|.:|:..||..:  |:.|..|...|.|. |..|.|.:....:.|  |.||||||||:|
Zfish    14 IMGEILGTFVLLLFGCAAAAQVKTSRETKGQFLSG-NIAFSVGVMSAMYLCRAVSGAHLNPAVSL 77

  Fly   110 ATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPES------AIYSAENPNGVCL------TS 162
            :..|...::....|.|.:||::||::..||:..:..::      .:.:...||....      |.
Zfish    78 SFCVLGDLAWIKLLPYSLAQILGAYLASGLVYLIYHDAIMEFSGGVLTVFGPNETASIFATYPTD 142

  Fly   163 LNSTLTPW--QGLAVEFLITCVLISVCCGVWDPRNATKQDS-LPVRFGLAIACLSLTAGQLTGAS 224
            :.|..|.:  |.:....|:.|:|     .:.|.|||...:: ||......:..:|::.....||:
Zfish   143 VVSVQTNFLDQVVGTAMLMLCIL-----PLNDKRNAPAPEALLPPIVATVVLGISISMSANCGAA 202

  Fly   225 MNPVRSFAPAI--WNGFWDDH---------WIYWVGPMAAALITSVIYKHAFRREL----EESEV 274
            :||.|...|.:  :...|...         ||..|.||...::.|:||....:..|    :|||.
Zfish   203 INPARDLGPRLFTFTAGWGTEVFTCYDYFFWIPLVAPMVGGVLGSIIYLVFIQWHLPELEDESES 267

  Fly   275 DETTMSTK 282
            .|....||
Zfish   268 GEMNDQTK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 62/241 (26%)
aqp10aNP_001002349.1 MIP 12..260 CDD:294134 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573490
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.