DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and MIP

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_036196.1 Gene:MIP / 4284 HGNCID:7103 Length:263 Species:Homo sapiens


Alignment Length:213 Identity:70/213 - (32%)
Similarity:106/213 - (49%) Gaps:6/213 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYV 113
            :.||..||...:|.|...|:..:.......|.|:.||..:...:|..|.:.|||:|||||.|..|
Human    13 IFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPAVTFAFLV 77

  Fly   114 YNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFL 178
            .:.:||..|..|..||::||..|..:|.:|.|.:.      ...:.|.:|:..::..|...||..
Human    78 GSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAV------RGNLALNTLHPAVSVGQATTVEIF 136

  Fly   179 ITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDH 243
            :|...:......:|.|...:..|:.:..|.::|...|.....|||.|||.|||||||..|.:.:|
Human   137 LTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNH 201

  Fly   244 WIYWVGPMAAALITSVIY 261
            |:|||||:....:.|::|
Human   202 WVYWVGPIIGGGLGSLLY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 69/211 (33%)
MIPNP_036196.1 MIP 3..219 CDD:333943 69/211 (33%)
NPA 1 68..70 1/1 (100%)
NPA 2 184..186 1/1 (100%)
Interaction with CALM. /evidence=ECO:0000250 227..237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.