DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Eglp4

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster


Alignment Length:232 Identity:129/232 - (55%)
Similarity:170/232 - (73%) Gaps:3/232 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LDSITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAV 107
            ||.|:..|.|:|.|.:|:||||||.|:..:|.|:..|..|||||.|||.|||||||.||||||||
  Fly    54 LDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAV 118

  Fly   108 TLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQG 172
            |:|.|:|.|::|.||.|||.|||:|||||||||..:||...:....   |:|:|..::::|..|.
  Fly   119 TVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGA---GLCVTLPHTSVTTGQA 180

  Fly   173 LAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWN 237
            |.:||:||.:|:.||||||||||:...||:.:|||||||||:..||..||.||||.||||||:||
  Fly   181 LGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWN 245

  Fly   238 GFWDDHWIYWVGPMAAALITSVIYKHAFRRELEESEV 274
            ..::.:||||:.|::::.||:..||..||||:.|:|:
  Fly   246 KHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 121/217 (56%)
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 120/215 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471467
Domainoid 1 1.000 93 1.000 Domainoid score I390
eggNOG 1 0.900 - - E1_COG0580
Homologene 1 1.000 - - H136579
Inparanoid 1 1.050 92 1.000 Inparanoid score I335
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26905
OrthoDB 1 1.010 - - D101773at6656
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm51421
orthoMCL 1 0.900 - - OOG6_100415
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
1312.810

Return to query results.
Submit another query.