DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and AQP7

DIOPT Version :10

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001161.1 Gene:AQP7 / 364 HGNCID:640 Length:342 Species:Homo sapiens


Alignment Length:114 Identity:25/114 - (21%)
Similarity:40/114 - (35%) Gaps:18/114 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EQILYFIAFFKLYFYVIHYRR------WEKLFYDLQIAFSSVMTNPSPE--IQGILGHVTKSTHN 129
            |.|:..:.|......::|:|.      .:..|.|..||.:|.:.....|  :|...|..:.|.. 
Human    55 EDIVDTMVFKPSDVLLVHFRNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDD- 118

  Fly   130 LTKYYSYVVNFNCAWYGVFRMLFIVVKYAVTGSYDVPLSTPIEAKYFIP 178
                |....:.:..|.......|....|.|..:||..||:     |.:|
Human   119 ----YDLESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSS-----YTVP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:444743 25/114 (22%)
AQP7NP_001161.1 MIP 31..280 CDD:444743 25/114 (22%)
NPA 1. /evidence=ECO:0000305|PubMed:36737436 94..96 0/1 (0%)
NPA 2. /evidence=ECO:0000305|PubMed:36737436 226..228
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.