DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and AQP6

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001643.2 Gene:AQP6 / 363 HGNCID:639 Length:282 Species:Homo sapiens


Alignment Length:248 Identity:89/248 - (35%)
Similarity:124/248 - (50%) Gaps:20/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSSEEPPSGKQTCRSQSNC--WLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVEN-SVFTNSDF 78
            |.:.||  |.:...|...|  |....|.|      .||.:||.:.:|.| :|||.. .....|..
Human     1 MDAVEP--GGRGWASMLACRLWKAISRAL------FAEFLATGLYVFFG-VGSVMRWPTALPSVL 56

  Fly    79 QSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAV 143
            |.|:.|..|..:.:|......|||.|||||||..|.:.||||.|:||..||:|||.:|..||..|
Human    57 QIAITFNLVTAMAVQVTWKASGAHANPAVTLAFLVGSHISLPRAVAYVAAQLVGATVGAALLYGV 121

  Fly   144 LPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGL 208
            :|      .:....:.:..:.::::..|.:|||.|:|..|:.......|.|..:  .|.....|:
Human   122 MP------GDIRETLGINVVRNSVSTGQAVAVELLLTLQLVLCVFASTDSRQTS--GSPATMIGI 178

  Fly   209 AIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIY 261
            ::|...|.....||.||||.|||.|||..|.:..||::||||:..||:.|:||
Human   179 SVALGHLIGIHFTGCSMNPARSFGPAIIIGKFTVHWVFWVGPLMGALLASLIY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 80/220 (36%)
AQP6NP_001643.2 MIP 25..231 CDD:294134 80/220 (36%)
NPA 1 82..84 1/1 (100%)
NPA 2 196..198 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.