DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and AQP5

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001642.1 Gene:AQP5 / 362 HGNCID:638 Length:265 Species:Homo sapiens


Alignment Length:235 Identity:81/235 - (34%)
Similarity:117/235 - (49%) Gaps:18/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLA 110
            :..|.||.:||.:.:|.|...:::......:..|.||.||..:....|..|.|.|.|:|||:|||
Human    11 LKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQALGPVSGGHINPAITLA 75

  Fly   111 TYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAV 175
            ..|.|.|||..|..|..||:|||..|.|:|..|.|.:|      ...:.:.:||:..|..|.:.|
Human    76 LLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNA------RGNLAVNALNNNTTQGQAMVV 134

  Fly   176 EFLIT-----CVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPA- 234
            |.::|     |:..|.     |.|..:...|..:..||::....|.....||.||||.|||.|| 
Human   135 ELILTFQLALCIFAST-----DSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAV 194

  Fly   235 IWNGFWDDHWIYWVGPMAAALITSVIYKH-AFRRELEESE 273
            :.|.|...||::||||:..|::.:::|.: .|...|..||
Human   195 VMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 76/220 (35%)
AQP5NP_001642.1 MIP 4..221 CDD:395174 76/220 (35%)
NPA 1. /evidence=ECO:0000305|PubMed:18768791, ECO:0000305|PubMed:26569106 69..71 1/1 (100%)
NPA 2. /evidence=ECO:0000305|PubMed:18768791, ECO:0000305|PubMed:26569106 185..187 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140767
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.