DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and AQP4

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001304313.1 Gene:AQP4 / 361 HGNCID:637 Length:352 Species:Homo sapiens


Alignment Length:264 Identity:90/264 - (34%)
Similarity:130/264 - (49%) Gaps:25/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SGKQTCRSQSNCWLLQRRQLDSIT-----------TVLAEMIATAMLMF-LGCMGSVENSVFTNS 76
            |.:.|.|....|..|..|:...:.           .|.||.:  |||:| |..:||..|...|..
Human     2 SDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFL--AMLIFVLLSLGSTINWGGTEK 64

  Fly    77 DFQ-----SALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIG 136
            ...     .:|.||..:...:||||.:.|.|:|||||:|......||:..::.|..||.:||.||
Human    65 PLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIG 129

  Fly   137 YGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDS 201
            .|:|..|.|.|.:      .|:.:|.::..||...||.||.:||..|:.......|.:......|
Human   130 AGILYLVTPPSVV------GGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGS 188

  Fly   202 LPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAFR 266
            :.:..|.::|...|.|...|||||||.|||.||:..|.|::||||||||:..|::...:|::.|.
Human   189 IALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFC 253

  Fly   267 RELE 270
            .::|
Human   254 PDVE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 82/236 (35%)
AQP4NP_001304313.1 MIP 31..248 CDD:278651 81/224 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140763
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.