DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and AQP3

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_004916.1 Gene:AQP3 / 360 HGNCID:636 Length:292 Species:Homo sapiens


Alignment Length:276 Identity:83/276 - (30%)
Similarity:121/276 - (43%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVF---TNSDFQSA-LNFGFVVLICIQ 93
            |.|..:...:...:...|||.:.|.:|:..|| |||...|.   |:..|.:. |.|||.|.:.|.
Human     9 SRCGEMLHIRYRLLRQALAECLGTLILVMFGC-GSVAQVVLSRGTHGGFLTINLAFGFAVTLGIL 72

  Fly    94 CFGCVCGAHLNPAVTLATYVY---NMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAEN- 154
            ..|.|.|||||||||.|....   ..|.||:   |.:||.:|||:|.|::..:..::..:.|:| 
Human    73 IAGQVSGAHLNPAVTFAMCFLAREPWIKLPI---YTLAQTLGAFLGAGIVFGLYYDAIWHFADNQ 134

  Fly   155 -----PNGVC----------LTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPV 204
                 |||..          |..:|.....:.|.|  .||.|||..|     ||.|......|..
Human   135 LFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTA--SLIVCVLAIV-----DPYNNPVPRGLEA 192

  Fly   205 -RFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGF--W-------DDHWIYWVGPMAAALITSV 259
             ..||.:..:..:.|..:|.::||.|.|.|.::...  |       ..|| :|| |:.:.|:.|:
Human   193 FTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQHW-WWV-PIVSPLLGSI 255

  Fly   260 ----IYKHAFRRELEE 271
                :|:......||:
Human   256 AGVFVYQLMIGCHLEQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 78/256 (30%)
AQP3NP_004916.1 MIP 23..264 CDD:238204 79/253 (31%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140754
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.