DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and AQP2

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_000477.1 Gene:AQP2 / 359 HGNCID:634 Length:271 Species:Homo sapiens


Alignment Length:272 Identity:83/272 - (30%)
Similarity:127/272 - (46%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVEN------SVFTNSDFQSALNFGFVVLICIQC 94
            |.|  |.:.....|.||.:||.:.:|.| :||..|      ||     .|.|:.||..:...:|.
Human     2 WEL--RSIAFSRAVFAEFLATLLFVFFG-LGSALNWPQALPSV-----LQIAMAFGLGIGTLVQA 58

  Fly    95 FGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVC 159
            .|.:.|||:|||||:|..|...:|:..|..|..||::||..|..||..:.|      |:....:.
Human    59 LGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQLLGAVAGAALLHEITP------ADIRGDLA 117

  Fly   160 LTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGAS 224
            :.:|:::.|..|.:.||..:|..|:.......|.|......:..:..|.::|...|.....||.|
Human   118 VNALSNSTTAGQAVTVELFLTLQLVLCIFASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCS 182

  Fly   225 MNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAF---RRELE---------ESEVDET 277
            |||.||.|||:..|.:||||::|:||:..|::.|::|.:..   .:.|.         |.:.|..
Human   183 MNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWE 247

  Fly   278 TMSTKRTSEAEL 289
            ....:|....||
Human   248 EREVRRRQSVEL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 74/225 (33%)
AQP2NP_000477.1 MIP 3..219 CDD:278651 75/229 (33%)
NPA 1. /evidence=ECO:0000305|PubMed:24733887 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000305|PubMed:24733887 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..271 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140758
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.