DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and AQP1

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001316801.1 Gene:AQP1 / 358 HGNCID:633 Length:323 Species:Homo sapiens


Alignment Length:221 Identity:72/221 - (32%)
Similarity:104/221 - (47%) Gaps:15/221 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLAEMIATAMLMFLGCMGSV--------ENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNP 105
            |:||.:||.:.:|:. :||.        .|......:.:.:|.||..:....|..|.:.||||||
Human    14 VVAEFLATTLFVFIS-IGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHISGAHLNP 77

  Fly   106 AVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPW 170
            ||||...:...||:..||.|.:||.|||.:...:|      |.|.|:...|.:....|...:...
Human    78 AVTLGLLLSCQISIFRALMYIIAQCVGAIVATAIL------SGITSSLTGNSLGRNDLADGVNSG 136

  Fly   171 QGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAI 235
            |||.:|.:.|..|:.......|.|......|.|:..||::|...|.|...||..:||.|||..|:
Human   137 QGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAV 201

  Fly   236 WNGFWDDHWIYWVGPMAAALITSVIY 261
            ....:.:|||:||||.....:..:||
Human   202 ITHNFSNHWIFWVGPFIGGALAVLIY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 70/219 (32%)
AQP1NP_001316801.1 NPA 1 76..78 1/1 (100%)
NPA 2 192..194 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.