DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp-12

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001022480.1 Gene:aqp-12 / 3565789 WormBaseID:WBGene00013272 Length:243 Species:Caenorhabditis elegans


Alignment Length:145 Identity:34/145 - (23%)
Similarity:60/145 - (41%) Gaps:29/145 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LAEMIATAMLMFLGCM-GSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYV 113
            :.|.:...:..||.|. |..:.|......|.||  |...:..|:  ...:..||||||::|..::
 Worm    24 IGEFLGAVIFSFLACFAGQYQRSNDLVYPFLSA--FSLYIARCL--VSHLTPAHLNPAISLLQWL 84

  Fly   114 YNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVE-- 176
            .|.|.|.:.:.:...|::|...|..|.:|::.:              |..|..:..::.:||:  
 Worm    85 RNEIPLVLLITFCFVQLIGFLFGVTLFRALVTQ--------------TEFNDYIVMYEIVAVDGT 135

  Fly   177 --------FLITCVL 183
                    ||:..||
 Worm   136 RKINRLQAFLLEVVL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 34/145 (23%)
aqp-12NP_001022480.1 MIP 24..>155 CDD:294134 34/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2379
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.