DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Aqp8

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_062031.1 Gene:Aqp8 / 29172 RGDID:2146 Length:263 Species:Rattus norvegicus


Alignment Length:259 Identity:81/259 - (31%)
Similarity:127/259 - (49%) Gaps:24/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSSEEPP---------SGKQTCRSQS---NCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVE 69
            ||.|:.|         .||:|..:.|   ..|..|     .|...:.|::.:|:.:|:||:..:|
  Rat     1 MSGEQTPMCSMDLREIKGKETNMADSYHGMSWYEQ-----YIQPCVVELLGSALFIFIGCLSVIE 60

  Fly    70 NSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAF 134
            ||..|.. .|.||..|..:.:.|...|.:.|.|.||||:||..:...:...:.:.|:|:|:.|..
  Rat    61 NSPNTGL-LQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGM 124

  Fly   135 IGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLI-SVCCGVWDPRNATK 198
            ||..|.|.|.||...:   |.:|.....:.......:.|.||.::|.:|: :||.|..:.:  |.
  Rat   125 IGAALAKVVSPEERFW---NASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVNEK--TM 184

  Fly   199 QDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYK 262
            ....|...|.::....|..|.::||.|||.|:|.||:..|:||.|||||:||:.|.|...::.:
  Rat   185 GPLAPFSIGFSVIVDILAGGGISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 71/220 (32%)
Aqp8NP_062031.1 MIP 40..250 CDD:294134 70/215 (33%)
NPA 1 94..96 1/1 (100%)
NPA 2 212..214 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334470
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.