DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Aqp7

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_062030.2 Gene:Aqp7 / 29171 RGDID:2145 Length:269 Species:Rattus norvegicus


Alignment Length:255 Identity:66/255 - (25%)
Similarity:108/255 - (42%) Gaps:40/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LDSITTV---------LAEMIATAMLMFLGCMGSVENSVF---TNSDFQSALNFGFVVLICIQCF 95
            |::|.:|         |||.::|.:||..| :|||.:.|.   ..|.....|.|||.|.:.|...
  Rat     6 LENIQSVLQKTWVREFLAEFLSTYVLMVFG-LGSVAHMVLGERLGSYLGVNLGFGFGVTMGIHVA 69

  Fly    96 GCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIG--------YGLLKAVL-PESAIYS 151
            |.:.|||:|.|||........::......|.:.|.:|:|:.        ||.:.... .|..:..
  Rat    70 GGISGAHMNAAVTFTNCALGRMAWKKFPIYVLGQFLGSFLAAATTYLIFYGAINHYAGGELLVTG 134

  Fly   152 AENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNA-TKQDSLPVRFGLAIACLSL 215
            .::...:..|.|...:|.|:|...|..:|.:|......:.|..|: ..|.:.|:..|:.:..|.:
  Rat   135 PKSTANIFATYLPEHMTLWRGFVDEVFVTGMLQLCIFAITDKLNSPALQGTEPLMIGILVCVLGV 199

  Fly   216 TAGQLTGASMNPVRSFAP------AIW--------NGFWDDHWIYWVGPMAAALITSVIY 261
            :.|..||.::||.|...|      |.|        |.:|   |:..|.|:..|.:..::|
  Rat   200 SLGMNTGYAINPSRDLPPRFFTFIAGWGKKVFSAGNNWW---WVPVVAPLLGAYLGGIVY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 65/253 (26%)
Aqp7NP_062030.2 MIP 15..260 CDD:412216 63/246 (26%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 78..80 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 210..212 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334457
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.