DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and SPAC977.17

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_592788.1 Gene:SPAC977.17 / 2543301 PomBaseID:SPAC977.17 Length:598 Species:Schizosaccharomyces pombe


Alignment Length:271 Identity:71/271 - (26%)
Similarity:106/271 - (39%) Gaps:32/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSSEEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVFTN---SDF 78
            ::.|...||..|.....|.|...|.   ......||.:.|.:|:..| :||...:..||   ..|
pombe   284 IAEESLDSGSDTETLYLNYWCKIRH---FFREGFAEFLGTLVLVVFG-VGSNLQATVTNGAGGSF 344

  Fly    79 QSALNF--GFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLK 141
            :| |:|  ||..::.:...|.:.|.|:|||||::..::..........|...|:.|||.| |.|.
pombe   345 ES-LSFAWGFGCMLGVYIAGGISGGHVNPAVTISLAIFRKFPWYKVPIYIFFQIWGAFFG-GALA 407

  Fly   142 AVLPESAIYSAEN-------PNGVCLTSLNSTLTPWQGLAV-EFLITCVLISVCCGVWDPRNATK 198
            .....|:|...|.       ..|.||.:.......|:.... ||:.|.||:.....:.|..|:..
pombe   408 YGYHWSSITEFEGGKDIRTPATGGCLYTNPKPYVTWRNAFFDEFIGTAVLVGCLFAILDDTNSPP 472

  Fly   199 QDSLPVRF-GLAIACLSLTAGQLTGASMNPVRSFAP---AIWNGF---------WDDHWIYWVGP 250
            ...:.... ||.||.:.:..|..|..::||.|...|   |.|.|:         |...|..|.|.
pombe   473 TQGMTAFIVGLLIAAIGMALGYQTSFTLNPARDLGPRMFAWWIGYGPHSFHLYHWWWTWGAWGGT 537

  Fly   251 MAAALITSVIY 261
            :...:...:||
pombe   538 IGGGIAGGLIY 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 62/245 (25%)
SPAC977.17NP_592788.1 MIP 311..520 CDD:238204 58/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I2575
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47106
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.