DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Aqp2

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_037041.3 Gene:Aqp2 / 25386 RGDID:2142 Length:271 Species:Rattus norvegicus


Alignment Length:266 Identity:81/266 - (30%)
Similarity:124/266 - (46%) Gaps:20/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCG 100
            |.|  |.:.....||||.:||.:.:|.|...:::.:....|..|.|:.||..:...:|..|.|.|
  Rat     2 WEL--RSIAFSRAVLAEFLATLLFVFFGLGSALQWASSPPSVLQIAVAFGLGIGTLVQALGHVSG 64

  Fly   101 AHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNS 165
            ||:|||||:|..|...:|...|..|..||::||..|..:|..:.|      .|....:.:.:|::
  Rat    65 AHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITP------VEIRGDLAVNALHN 123

  Fly   166 TLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRS 230
            ..|..|.:.||..:|..|:.......|.|......|..:..|.::....|.....||.||||.||
  Rat   124 NATAGQAVTVELFLTMQLVLCIFASTDERRGDNLGSPALSIGFSVTLGHLLGIYFTGCSMNPARS 188

  Fly   231 FAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAF---RRELE---------ESEVDETTMSTKR 283
            .|||:..|.:||||::|:||:..|:|.|::|.:..   .:.|:         |.:.|......:|
  Rat   189 LAPAVVTGKFDDHWVFWIGPLVGAIIGSLLYNYLLFPSAKSLQERLAVLKGLEPDTDWEEREVRR 253

  Fly   284 TSEAEL 289
            ....||
  Rat   254 RQSVEL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 72/219 (33%)
Aqp2NP_037041.3 MIP 3..219 CDD:395174 73/223 (33%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P41181 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P41181 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..271 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.