DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Aqp4

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_038952509.1 Gene:Aqp4 / 25293 RGDID:2143 Length:380 Species:Rattus norvegicus


Alignment Length:235 Identity:83/235 - (35%)
Similarity:123/235 - (52%) Gaps:18/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLAEMIATAMLMFLGC-----MGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVT 108
            |.||.:|..:.:.|..     .|..||.:..:....| |.||..:...:||||.:.|.|:|||||
  Rat    79 VTAEFLAMLIFVLLSVGSTINWGGSENPLPVDMVLIS-LCFGLSIATMVQCFGHISGGHINPAVT 142

  Fly   109 LATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGL 173
            :|......||:..::.|..||.:||.||.|:|..|.|.|.:      .|:.:|:::..||...||
  Rat   143 VAMVCTRKISIAKSVFYITAQCLGAIIGAGILYLVTPPSVV------GGLGVTTVHGNLTAGHGL 201

  Fly   174 AVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNG 238
            .||.:||..|:.......|.:......|:.:..|.::|...|.|...|||||||.|||.||:..|
  Rat   202 LVELIITFQLVFTIFASCDSKRTDVTGSVALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMG 266

  Fly   239 FWDDHWIYWVGPMAAALITSVIYKHAF------RRELEES 272
            .|::||||||||:..|::...:|::.|      :|.|:|:
  Rat   267 NWENHWIYWVGPIIGAVLAGALYEYVFCPDVELKRRLKEA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 78/216 (36%)
Aqp4XP_038952509.1 MIP 72..289 CDD:395174 78/216 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334448
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.