DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Aqp5

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_036911.1 Gene:Aqp5 / 25241 RGDID:2144 Length:265 Species:Rattus norvegicus


Alignment Length:219 Identity:73/219 - (33%)
Similarity:113/219 - (51%) Gaps:17/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYV 113
            |.||.:||.:.:|.|...:::......:..|.::.||..:....|..|.|.|.|:|||:|||..:
  Rat    14 VFAEFLATLIFVFFGLGSALKWPSALPTILQISIAFGLAIGTLAQALGPVSGGHINPAITLALLI 78

  Fly   114 YNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFL 178
            .|.|||..|:.|..||:|||..|.|:|..:.|.:|      ...:.:.:||:..||.:.:.||.:
  Rat    79 GNQISLLRAVFYVAAQLVGAIAGAGILYWLAPLNA------RGNLAVNALNNNTTPGKAMVVELI 137

  Fly   179 IT-----CVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPA-IWN 237
            :|     |:..|.     |.|..:...|..:..||::....|.....||.||||.|||.|| :.|
  Rat   138 LTFQLALCIFSST-----DSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMN 197

  Fly   238 GFWDDHWIYWVGPMAAALITSVIY 261
            .|...||::||||:..|::.:::|
  Rat   198 RFSPSHWVFWVGPIVGAMLAAILY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 72/217 (33%)
Aqp5NP_036911.1 MIP 4..221 CDD:395174 72/217 (33%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 69..71 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 185..187 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.