DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp-6

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001256246.1 Gene:aqp-6 / 183121 WormBaseID:WBGene00000174 Length:291 Species:Caenorhabditis elegans


Alignment Length:239 Identity:75/239 - (31%)
Similarity:114/239 - (47%) Gaps:36/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AEMIATAMLMFLGCMGSVENSVFTNSD-FQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVY 114
            ||.||..:.:::|.|.:.  .||.:.. ..:|...|..:.:....||.|.|||:|||||....:.
 Worm    63 AEFIAVLLFVYIGSMQAA--GVFLHDGVLHAAFAHGVAIFVLAATFGGVSGAHINPAVTFGIALV 125

  Fly   115 NMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLT----PWQ-GLA 174
            ..||...|:.|.|:|::|:..|..|::..||    |...|     :.|..:||.    .|| ||.
 Worm   126 GRISPIHAVCYVVSQLLGSVFGALLVRISLP----YKMYN-----VISAGATLCGKGYNWQEGLT 181

  Fly   175 VEFLITCVLIS--VCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWN 237
            .|.:.|.:|:.  :.|.|    :..|....|:..|.::....|.||.::||||||.|||.|.|..
 Worm   182 AEIVTTYILVQTVLLCAV----DTDKNRLAPLAIGFSLIIEILAAGAISGASMNPARSFGPNIMG 242

  Fly   238 G-------------FWDDHWIYWVGPMAAALITSVIYKHAFRRE 268
            .             :|:.||||::||:..|.|.:.:|:..|.|:
 Worm   243 QVFLKPEHLDAQYMYWNYHWIYYIGPIIGAFIAAGVYRMFFARD 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 72/230 (31%)
aqp-6NP_001256246.1 MIP 60..282 CDD:238204 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm4734
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.