DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp-7

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001379301.1 Gene:aqp-7 / 180589 WormBaseID:WBGene00000175 Length:302 Species:Caenorhabditis elegans


Alignment Length:279 Identity:69/279 - (24%)
Similarity:114/279 - (40%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQS--ALNFGFVVLICIQCFGC--VCGAHLNPA 106
            :...|:|...|.:|:|:| :|.|...:.:|....:  .:|.|:.:.|....:.|  ..|.|.|||
 Worm    33 LRNALSEFFGTFLLLFIG-IGIVMQFILSNEKLNTWININLGWGLAIAFTVYTCSKTSGGHFNPA 96

  Fly   107 VTLATYVYNMISLPMALAYFVAQMVGAFIG----YGLL--KAVLPESAIYSAENPNGV--CLTSL 163
            |::|......:.....|.|.|.|.:||.:|    :||.  :.|....|..:...|...  |..|.
 Worm    97 VSIAFLTLGKLPFKDFLVYCVVQTIGAALGSAAAFGLYYDQFVKFAGAYRTILGPKATAGCFCSY 161

  Fly   164 ------NST--LTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQL 220
                  |:|  ...:.|.|:..|..||:|       |.||.....:.|:.|||.:..:....|..
 Worm   162 PALHVSNTTAFFDQFAGTALLVLFVCVVI-------DKRNGIPGAAHPLLFGLVVMMIGTAYGMN 219

  Fly   221 TGASMNPVRSFAPAIW------NGFWDDH-WIYWVGPMAAALITSVI--YKHAF--------RRE 268
            .|..:||.|...|.::      :|.:..| :.:|: |:.|.|..::.  :.:.|        :||
 Worm   220 LGYPINPARDLGPRLFSFFIYGSGVFSYHSYYFWI-PVIAPLFGAIFGAWSYTFFVGAHIPDQRE 283

  Fly   269 LEESEVDETTMSTKRTSEA 287
            .....|||.....|..::|
 Worm   284 TTYVLVDEANQPLKLATDA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 61/243 (25%)
aqp-7NP_001379301.1 MIP 34..273 CDD:238204 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.