DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp-4

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_505512.3 Gene:aqp-4 / 179366 WormBaseID:WBGene00000172 Length:273 Species:Caenorhabditis elegans


Alignment Length:272 Identity:81/272 - (29%)
Similarity:128/272 - (47%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSS-EEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVFTNSD--F 78
            ||| .|...|:....::.:.:..::::...:|..:||.:.....:::|.|   :.|:|..:|  .
 Worm    14 MSSYAEETWGQPATTNRKSSYTSRKKEYSLLTKCVAEFLGDLTFVYVGTM---QASLFQYADGIL 75

  Fly    79 QSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAV 143
            .:|...||.:.|.:..||.:.|.|.||||:.|......:.:.....|.|:|::|...|..|..||
 Worm    76 HAAFAHGFTIFILVTAFGHISGGHFNPAVSWAIAGAGKMPIFHLPFYVVSQLLGGICGAFLTAAV 140

  Fly   144 LPESAIYSAENPNGVCLTSLNSTLTPWQGLAVE-----FLITCVLISVCCGVWDPRNATKQDSL- 202
            |.:..:.|.|  .|..|.|..|..  ||||..|     ||:..:||:          |...|:: 
 Worm   141 LSQEQLTSCE--AGATLLSPGSQW--WQGLIAETVVTFFLVHTILIT----------AADTDTVT 191

  Fly   203 --PVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNG---------FWDDHWIYWVGPMAAALI 256
              |:..||.::...|:.|.:|||||||.||..|:|...         :|::|:|||.||:..:.|
 Worm   192 LAPLAIGLTLSIDILSTGSITGASMNPARSLGPSIIGSIFATQKTSFYWNNHYIYWAGPLLGSTI 256

  Fly   257 TSVIYKHAFRRE 268
            ...|||....||
 Worm   257 ALCIYKLFESRE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 71/238 (30%)
aqp-4NP_505512.3 MIP 46..264 CDD:238204 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156132
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm4734
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.