DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp-2

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001379056.1 Gene:aqp-2 / 174467 WormBaseID:WBGene00000170 Length:290 Species:Caenorhabditis elegans


Alignment Length:283 Identity:67/283 - (23%)
Similarity:112/283 - (39%) Gaps:37/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RRQLDSITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQSAL----NFGFVVLICIQCFGCVCG 100
            |::|  :..||||...|.:|..:| :..|...|....:....:    .||..::..:.....:.|
 Worm    13 RKEL--LRAVLAEFTGTYLLCLIG-LSVVAQKVLPRPEVNEFIGVNVGFGIAIVFGVAVSAKLSG 74

  Fly   101 AHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPES---------AIYSAENPN 156
            .|:||||:.|......|::...:||||||..|||.|...:.||..::         .:...::..
 Worm    75 GHINPAVSFAFLSVGQITIVQFIAYFVAQFFGAFFGAATVYAVYNDAINVFDGGVRTVGGPKDTA 139

  Fly   157 GVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLT 221
            |:..:.....|....|...:|:.|.|.:.:...:.|.||:......|:..|.....:....|...
 Worm   140 GIFASYPAPHLGLVNGFVDQFVATAVFVFLIAHIVDKRNSYPTWLQPILVGTGFVAIGAAFGYNC 204

  Fly   222 GASMNPVRSFAPAIWNGF---------WDDHWIYWVGPMAAALITSVIYKHAF----RRELEESE 273
            |..:||.|.|||.::...         |  .|:..|||...|::...:|....    .::.||..
 Worm   205 GYPVNPARDFAPRLFTSIFYGGAVFTKW--FWVPIVGPFVGAVVGIWLYYFLIGFHTPQDAEEKY 267

  Fly   274 VDET------TMSTKRTSEAELA 290
            |..|      .::.|.|.:.|.|
 Worm   268 VVLTGNQELKPLTAKETVDEEAA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 57/241 (24%)
aqp-2NP_001379056.1 MIP 18..254 CDD:238204 57/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.