DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Mip

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_032626.2 Gene:Mip / 17339 MGIID:96990 Length:263 Species:Mus musculus


Alignment Length:218 Identity:73/218 - (33%)
Similarity:107/218 - (49%) Gaps:16/218 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYV 113
            :.||..||...:|.|...|:..:.......|.||.||..:...:|..|.:.|||:|||||.|..|
Mouse    13 IFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQTVGHISGAHVNPAVTFAFLV 77

  Fly   114 YNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFL 178
            .:.:||..|..|..||::||..|..:|.:|.|.:.      ...:.|.:|::.::..|...||..
Mouse    78 GSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPPAV------RGNLALNTLHAGVSVGQATTVEIF 136

  Fly   179 ITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQL-----TGASMNPVRSFAPAIWNG 238
            :|...:......:|.|...:..|:.:..|     .|||.|.|     |||.|||.|||||||...
Mouse   137 LTLQFVLCIFATYDERRNGRMGSVALAVG-----FSLTLGHLFGMYYTGAGMNPARSFAPAILTR 196

  Fly   239 FWDDHWIYWVGPMAAALITSVIY 261
            .:.:||:|||||:....:.|::|
Mouse   197 NFSNHWVYWVGPIIGGGLGSLLY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 72/216 (33%)
MipNP_032626.2 MIP 3..219 CDD:395174 72/216 (33%)
Important for formation of cell junction. /evidence=ECO:0000250 34..38 0/3 (0%)
NPA 1 68..70 1/1 (100%)
NPA 2 184..186 1/1 (100%)
Interaction with CALM. /evidence=ECO:0000250 227..237
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.