DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Aqp8

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_031500.1 Gene:Aqp8 / 11833 MGIID:1195271 Length:261 Species:Mus musculus


Alignment Length:252 Identity:77/252 - (30%)
Similarity:124/252 - (49%) Gaps:9/252 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GHQMKMSSEEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVFTNS 76
            |.|..|.|.:.|..|........|.:....|.  :...:.|::.:|:.:|:||:..:|||..|..
Mouse     3 GEQTPMCSMDLPEVKVKTSMAGRCRVFWYEQY--VQPCIVELVGSALFIFIGCLSVIENSPNTGL 65

  Fly    77 DFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLK 141
             .|.||..|..:.:.|...|.:.|.|.||||:||..|...:...:.:.|:::|:.|..||..|.|
Mouse    66 -LQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTVIGGLKTMLLIPYWISQLFGGLIGAALAK 129

  Fly   142 AVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLI-SVCCGVWDPRNATKQDSLPVR 205
            .|.||...:   |.:|.....:.......:.|.:|.::|.:|: :||.|..:.:  |.....|..
Mouse   130 VVSPEERFW---NASGAAFAIVQEQEQVAEALGIEIILTMLLVLAVCMGAVNEK--TMGPLAPFS 189

  Fly   206 FGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYK 262
            .|.::....|..|.::||.|||.|:|.||:..|:||.|||||:||:.|.|...::.:
Mouse   190 IGFSVIVDILAGGSISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 70/220 (32%)
Aqp8NP_031500.1 MIP 38..248 CDD:294134 69/215 (32%)
NPA 1 92..94 1/1 (100%)
NPA 2 210..212 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830758
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2379
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.