DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Aqp7

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001365567.1 Gene:Aqp7 / 11832 MGIID:1314647 Length:316 Species:Mus musculus


Alignment Length:228 Identity:58/228 - (25%)
Similarity:102/228 - (44%) Gaps:22/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVF-TNSDFQSALN-- 83
            |.|..:|.:|     :||:   :.:...|||.::|.::|..| :|||.:.|. .||.....:|  
Mouse     3 PRSVLETIQS-----VLQK---NMVREFLAEFLSTYVMMVFG-LGSVAHMVLGENSGSYLGVNLG 58

  Fly    84 FGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAF--------IGYGLL 140
            |||.|.:.:...|.:.|||:|.|||........::......|.:.|.:|:|        |.||.:
Mouse    59 FGFGVTMGVHVAGGISGAHMNAAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYGAI 123

  Fly   141 KAVLPESAIYSAENPN-GVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNA-TKQDSLP 203
            ........:.:..... .:..|.|...:|.|:|...|..:|.:|......:.|.:|: ..|.:.|
Mouse   124 NHFAGGDLLVTGSKATANIFATYLPEYMTLWRGFLDEAFVTGMLQLCLFAITDKKNSPALQGTEP 188

  Fly   204 VRFGLAIACLSLTAGQLTGASMNPVRSFAPAIW 236
            :..|:.:..|.::.|..:|.::||.|...|.::
Mouse   189 LVIGILVTVLGVSLGMNSGYAINPSRDLPPRLF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 52/209 (25%)
Aqp7NP_001365567.1 MIP 18..232 CDD:412216 52/205 (25%)
NPA 1 79..81 1/1 (100%)
NPA 2 211..213 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830745
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.