DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Aqp6

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_780296.1 Gene:Aqp6 / 11831 MGIID:1341204 Length:293 Species:Mus musculus


Alignment Length:230 Identity:85/230 - (36%)
Similarity:112/230 - (48%) Gaps:9/230 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SNCWLLQRRQLDSITTVL-AEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFG 96
            |..:||......:|:..| ||.:||.:.:|.|....:...|...|..|.|:.|.......:|...
Mouse     7 SRAYLLVGGLWTAISKALFAEFLATGLYVFFGVGSVLPWPVALPSVLQIAITFNLATATAVQISW 71

  Fly    97 CVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLT 161
            ...|||.|||||||..|.:.||||.|:||..||:.||..|..||..|.| ..|......|.|   
Mouse    72 KTSGAHANPAVTLAYLVGSHISLPRAMAYIAAQLAGATAGAALLYGVTP-GGIRETLGVNVV--- 132

  Fly   162 SLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMN 226
             .|||.| .|.:|||.::|..|:.......|.|......:..:  |.::|...|.....||.|||
Mouse   133 -HNSTST-GQAVAVELVLTLQLVLCVFASMDGRQTLASPAAMI--GTSVALGHLIGIYFTGCSMN 193

  Fly   227 PVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIY 261
            |.|||.||:..|.:..|||:||||:..|::.|:||
Mouse   194 PARSFGPAVIVGKFAVHWIFWVGPLTGAVLASLIY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 80/220 (36%)
Aqp6NP_780296.1 MIP 22..228 CDD:294134 79/213 (37%)
NPA 1 79..81 1/1 (100%)
NPA 2 193..195 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830762
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.