DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and LOC101733960

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_031752084.1 Gene:LOC101733960 / 101733960 -ID:- Length:228 Species:Xenopus tropicalis


Alignment Length:205 Identity:76/205 - (37%)
Similarity:102/205 - (49%) Gaps:24/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VLAEMIATAML--MFLG--CMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTL 109
            ||||.:.|.||  :.||  |:|.   .|..:.....||..||.|:..:||||.:.||.||||:|.
 Frog    16 VLAETLGTFMLVTVVLGSSCLGL---RVSRSDSLLPALAAGFTVVSLVQCFGEISGAQLNPAITS 77

  Fly   110 ATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVC---LTSLNSTLTPWQ 171
            |......:.|...:|:.|||.|||.....|....:|||          ||   :|.::|.....|
 Frog    78 ALVCARKLDLLHGMAFAVAQCVGATCASALFYVCMPES----------VCNQLVTRVSSEGNAGQ 132

  Fly   172 GLAVEFLITCVLISVCCGVWD--PRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPA 234
            .||:|...|..|......|.|  .|:.|:..||.:  |.::...:|||||::|.||||.||..||
 Frog   133 ALAMEVFATFQLAFTIFAVDDRRRRDLTEPGSLAI--GFSVTAGALTAGQVSGGSMNPARSLGPA 195

  Fly   235 IWNGFWDDHW 244
            :..|.|:.||
 Frog   196 LVTGIWEHHW 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 76/205 (37%)
LOC101733960XP_031752084.1 MIP 6..205 CDD:412216 74/203 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.