DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and LOC100509620

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_006712950.1 Gene:LOC100509620 / 100509620 -ID:- Length:375 Species:Homo sapiens


Alignment Length:243 Identity:65/243 - (26%)
Similarity:102/243 - (41%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LAEMIATAMLMFLGCMGSVENSVFTNSDFQS----ALNFGFVVLICIQCFGCVCGAHLNPAVTLA 110
            |||.::|.::|..| :|||.:.|. |..:.|    .|.|||.|.:.:...|.:.|||:|.|||..
Human    71 LAEFMSTYVMMVFG-LGSVAHMVL-NKTYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFT 133

  Fly   111 TYVYNMISLPMALAYFVAQMVGAFIG----YGLL-KAVL----PESAIYSAENPNGVCLTSLNST 166
            ......:.......:.:.|.:|:|:.    |.|. .|:|    .|..:.......|:..|.|...
Human   134 NCALGRVPWRKFPVHVLGQFLGSFLAAATIYSLFYTAILHFSGGELMVTGPFATAGIFATYLPDH 198

  Fly   167 LTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACL----SLTAGQLTGASMNP 227
            :|.|:|...|..:|.:|......:.|..|   ..:||....|.|:.|    .::.|..||.::||
Human   199 MTLWRGFLNEEWLTRMLQLCLFTITDQEN---NPALPGTHALVISILVVIIRVSHGINTGYAINP 260

  Fly   228 VRSFAPAI------W--------NGFWDDHWIYWVGPMAAALITSVIY 261
            .|...|:|      |        ..:|   |:..|.|:..|.:..:||
Human   261 SRDPPPSIFTFIAGWGKQVFSDGENWW---WVPVVAPLLGASLGGIIY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 63/241 (26%)
LOC100509620XP_006712950.1 MIP 64..313 CDD:294134 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140772
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.