DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and LOC100497434

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_002937066.2 Gene:LOC100497434 / 100497434 -ID:- Length:259 Species:Xenopus tropicalis


Alignment Length:222 Identity:66/222 - (29%)
Similarity:111/222 - (50%) Gaps:16/222 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ITTVLAEMIATAMLMFLGCMGSVENSVFTN----SDFQSALNFGFVVLICIQCFGCVCGAHLNPA 106
            |...:||::.:.:.:||||:     ||..|    .....||..||.:...|...|.|.|.|.|||
 Frog    36 IQPCVAELLGSTLFIFLGCL-----SVLVNPHNAGPLLPALVHGFTLASVISVLGNVSGGHFNPA 95

  Fly   107 VTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQ 171
            |||:..:...::..:.:.|:|.|:.|..:|..|.|.:....:..:  :....|:......:.  :
 Frog    96 VTLSVVICGGLTPILLVPYWVCQLSGGMLGALLAKGLADHGSFIN--HTGAACMLGSGDLVA--R 156

  Fly   172 GLAVEFLITCVLI-SVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAI 235
            .:.||.:::.:|| :|..|.....:.|......:.|.|..|.||  .|.::|:.:||.|:..||:
 Frog   157 AVGVEIVLSFLLIFTVVMGAVGELSKTPLAPYSIAFVLTAAILS--GGSISGSCLNPARALGPAV 219

  Fly   236 WNGFWDDHWIYWVGPMAAALITSVIYK 262
            ...:||.||:|||||:|.||:.|::|:
 Frog   220 VANYWDYHWVYWVGPLAGALLVSLLYR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 65/219 (30%)
LOC100497434XP_002937066.2 MIP 34..245 CDD:294134 65/219 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4373
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.