DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp9

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_002937719.2 Gene:aqp9 / 100493943 XenbaseID:XB-GENE-481514 Length:304 Species:Xenopus tropicalis


Alignment Length:239 Identity:73/239 - (30%)
Similarity:106/239 - (44%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LAEMIATAMLMFLGCMGSVENSVFTN-SDFQSALNFGFVVLICIQCF--GCVCGAHLNPAVTLAT 111
            |:|..||.:|:.||| |.|..||.:| ||.....|.||.:.:.|..:  |.|.|.|:||||:.|.
 Frog    37 LSEFFATCLLIILGC-GCVATSVLSNTSDAYLTNNLGFAMAVTIAVYVSGGVSGGHINPAVSFAM 100

  Fly   112 YVYNMISLPMALAYFVAQMVGAFIG----YGLLKAVLPE--SAIYSAENPNG---VCLTSLNSTL 167
            .:...:.......|..||.:||..|    :|:....|..  ..|.:.:.||.   :..|.....|
 Frog   101 CLTGRLKWAKFPFYVSAQFLGAIAGSAAVFGIYYDALYNYTGGILTVDGPNATAYIFATYPKPYL 165

  Fly   168 TPWQGLAVEFLITCVLISVCCGVWDPRN-ATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSF 231
            :...|...:.:.|.:|:.....::|.:| .|.:...|:..||.|..|.|:.|..:|.:|||.|..
 Frog   166 SIMGGFVDQVMSTALLLIGVLAIFDNKNLGTPKGLEPIAVGLLILLLGLSLGMNSGCAMNPARDL 230

  Fly   232 APAI------W--------NGFWDDHWIYWVGPMAAALITSVIY 261
            .|.|      |        |.:|   |:..||||..|.|.:.||
 Frog   231 GPRIFTAMAGWGMEVFTSGNSWW---WVPVVGPMLGAAIGAFIY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 71/237 (30%)
aqp9XP_002937719.2 MIP 30..275 CDD:412216 73/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2121
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.