DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp10

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_002943404.2 Gene:aqp10 / 100490571 XenbaseID:XB-GENE-480662 Length:330 Species:Xenopus tropicalis


Alignment Length:319 Identity:69/319 - (21%)
Similarity:119/319 - (37%) Gaps:51/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MKMSSEEPPSGKQTCRSQSNCWLLQRRQLDSITTV--------LAEMIATAMLMFLGCMGSVENS 71
            ::.|...|.|...........|...||.|.|...:        |||.:...:|:.: .:.:....
 Frog     6 IRSSYLHPSSFSSAWHLSGMAWWRSRRDLRSCLRLRNPLARECLAEFLGVFVLLLI-TVAATAQG 69

  Fly    72 VFTNSD----FQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMI---SLPMALAYFVAQ 129
            |.:|..    |...|.....|::.|...|.|.|.|||||.:|:..:....   .||:   |.:.|
 Frog    70 VTSNETRGNFFCMYLAGAIAVVLAIYISGGVSGGHLNPAYSLSMCILGRFPWWKLPL---YALIQ 131

  Fly   130 MVGAFIGYGLLKAVLPES---------AIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLIS 185
            :||:|.|.....|:..::         .::.......:..:.....|:...|...:.:.|.:|:.
 Frog   132 LVGSFAGAAAAFALYYDAIRDYTKGNLTVFGPRETASIFSSYPAPYLSIGNGFLDQVMGTAMLMV 196

  Fly   186 VCCGVWDPRNATKQDSL-PVRFGLAIACLSLTAGQLTGASMNPVRSFAPAI------W------- 236
            ....:.|.:|......| |:..|:.:.|:.|:.|...|..:||.|...|.:      |       
 Frog   197 GILAIVDSKNKPVPRGLEPIVVGMLVFCIGLSMGANCGYPINPTRDLGPRLFTAVAGWGLDVFRA 261

  Fly   237 -NGFWDDHWIYWVGPMAAALITSVIYK-----HAFRRELEESEVDETTMSTKRTSEAEL 289
             |.:|   |:..|.|...|::.|::|:     |....|.||....|.....:.|.|.::
 Frog   262 GNNWW---WVPVVAPCVGAVLGSILYQILVEIHHPLAESEEEPPKEKEALQEDTKEVQV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 56/258 (22%)
aqp10XP_002943404.2 MIP 38..288 CDD:294134 54/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.