DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and LOC100489792

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_002935778.1 Gene:LOC100489792 / 100489792 -ID:- Length:267 Species:Xenopus tropicalis


Alignment Length:257 Identity:90/257 - (35%)
Similarity:124/257 - (48%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVY 114
            :||.:.|.:.:|.|...:::.:....|..|.:|.||..|...:|..|.:.|||||||||:|..|.
 Frog    14 VAEFLGTLVFVFFGLCSAMQWAPELPSVLQISLTFGLGVGTIVQAVGHISGAHLNPAVTIAFLVA 78

  Fly   115 NMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLI 179
            :.|||..||.|..||::||.:|..||....||    |.....||.|.|.|:  |..|.:.||.::
 Frog    79 SQISLFRALCYICAQLLGAVVGAALLHEFTPE----SVHGNFGVNLLSNNT--TEGQAVTVEMIL 137

  Fly   180 TCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDHW 244
            |..||.......|........|..:..||::|...|.....||.||||.|||.||:..|.:|.||
 Frog   138 TLQLILCVFASTDSNRCDNVGSPSISIGLSVAVGHLVGIYFTGCSMNPARSFGPALIAGNFDAHW 202

  Fly   245 IYWVGPMAAALITSVIYKH-------AFRREL----------EESEVDETTMSTKRTSEAEL 289
            |:|:||...|:|.|::|.:       :|..:|          ||.|.:|......|....||
 Frog   203 IFWIGPFTGAIIASLLYNYVLCPQQQSFSEKLSILLGRMPDKEEEEWEERQEQPSRRKSMEL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 80/210 (38%)
LOC100489792XP_002935778.1 MIP 3..219 CDD:333943 80/210 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.