DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp4

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001304775.1 Gene:aqp4 / 100487371 XenbaseID:XB-GENE-487854 Length:345 Species:Xenopus tropicalis


Alignment Length:246 Identity:86/246 - (34%)
Similarity:124/246 - (50%) Gaps:22/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 AMLMF-LGCMGSVENSVFTNSDFQS-------ALNFGFVVLICIQCFGCVCGAHLNPAVTLATYV 113
            |||:| |..:||..|  ::..|...       ||.||..:...:||||.:.|.|:|||||:|...
 Frog    44 AMLIFVLLSLGSTIN--WSPKDNPQPADLVLIALCFGLSIATLVQCFGHISGGHINPAVTVAMVS 106

  Fly   114 YNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFL 178
            ...|||..::.|.|||.:||..|.|:|..|.|      ::....:..|.:|:.|:...||.||.:
 Frog   107 MRKISLAKSIFYIVAQCLGAIAGAGILYLVTP------SDVAGNLGATMVNTKLSSAHGLLVELI 165

  Fly   179 ITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDH 243
            ||..|:...|...||:......|:.:..|.::|...|.|...|||||||.|||.||:....|:.|
 Frog   166 ITFQLVFTICASCDPKRKDISGSVALAIGFSVAIGHLFAIPYTGASMNPARSFGPAVIMNKWESH 230

  Fly   244 WIYWVGPMAAALITSVIYKHAF------RRELEESEVDETTMSTKRTSEAE 288
            |:|||||:..|:|...:|::.:      :..|:|.....|..|..:..|.|
 Frog   231 WVYWVGPVLGAVIAGALYEYVYCPDPELKNHLKEVLNKATQPSKGKYKEVE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 79/211 (37%)
aqp4NP_001304775.1 MIP 31..248 CDD:278651 79/211 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.