DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp10b

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_005159449.1 Gene:aqp10b / 100034395 ZFINID:ZDB-GENE-060503-57 Length:309 Species:Danio rerio


Alignment Length:288 Identity:72/288 - (25%)
Similarity:121/288 - (42%) Gaps:43/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LLQRRQLDS--ITTVLAEMIATAMLMFLGC--MGSVENSVFTNSDFQSALNFGFVVLICIQCFGC 97
            ||:|.::.|  ....|||.....:|:..||  :..|..|..|..::.| :|.||.:   ...||.
Zfish     4 LLRRYRIKSRLPRECLAEFFGVYVLILFGCGSVAQVTTSQNTKGEYLS-INLGFAL---GTTFGI 64

  Fly    98 -----VCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLL-----KAVLP----ESA 148
                 |.||||||||:::..|....|......|..:|:.|||:....:     .|::.    ...
Zfish    65 YIAKGVSGAHLNPAVSVSLCVLGRFSWTRLPFYVCSQLFGAFLAAATVALQYYDAIMDFTGGHLT 129

  Fly   149 IYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSL-PVRFGLAIAC 212
            :..|....|:..|.....|:.|.|:..:.:.|..|:.....:.|..|......| ||..|.|:..
Zfish   130 VSGATATAGIFSTYPADYLSLWGGVVDQIIGTAALLVCVLALGDAHNTPAPAGLEPVLVGAAVLV 194

  Fly   213 LSLTAGQLTGASMNPVRSFAPAI------W--------NGFWDDHWIYWVGPMAAALITSVIYKH 263
            :.::.|..:|.::||.|.|.|.:      |        :|:|   |:..:.....||:.|::|:.
Zfish   195 IGISMGSNSGYAINPARDFGPRLFSYIAGWGDEVFRAGHGWW---WVPIIVTCVGALLGSLLYEL 256

  Fly   264 AFRRELEESEV---DETTMSTKRTSEAE 288
            .......:||.   ::.|.:.::|.|.|
Zfish   257 LIGVHHPDSEAVDHEDPTAALQQTVEME 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 62/252 (25%)
aqp10bXP_005159449.1 MIP 5..247 CDD:294134 61/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573486
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.640

Return to query results.
Submit another query.