DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ItgaPS5 and itgav

DIOPT Version :9

Sequence 1:NP_611808.2 Gene:ItgaPS5 / 37732 FlyBaseID:FBgn0034880 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_012825487.1 Gene:itgav / 100144691 XenbaseID:XB-GENE-488969 Length:1034 Species:Xenopus tropicalis


Alignment Length:1084 Identity:265/1084 - (24%)
Similarity:455/1084 - (41%) Gaps:215/1084 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SYFGYSLVIRPTS-----IFVGAPRAQSTLESQGSINETGAVYRCPLASGSC----------SHY 94
            ||||:::....:.     :.||||:|.:   ||..|.|.|.|.:|...:..|          .:|
 Frog    37 SYFGFAVDFLNSDSSGSYLLVGAPKANT---SQPGIIEGGDVIKCDWKNSECRSVVFDPNGNRNY 98

  Fly    95 VLNDKLN-KQFQWLGGSMDGGTKDTDKLLVCAPRF-FVPKNKNYGQMRGICYWVRD--TVADTPP 155
            .:|:.:. |..||.|.|:   ....:|::.|||.: :..:.|...:..|.|| :.|  ||.:..|
 Frog    99 AVNESIEFKSHQWFGASV---RAKHNKIMACAPLYHWRTEIKQEREPVGTCY-LNDGITVVEYAP 159

  Fly   156 L-SDVRTISLIPSQAEEHFMLELGLSAHVTDDNSGFLIGAPGVRSWKGSVLVHRGEDLAAQ---G 216
            . |:.:|      .|:|....:.|.|...|:||. .|:|.||...|:|.::..:.:::..:   .
 Frog   160 CRSNAKT------DAQEQGFCQGGFSIDFTEDNR-VLLGGPGSFYWQGQLISDQVDEIVKKYKPE 217

  Fly   217 SYAVKMLD---------SWDWVKNHFTYVGYALSSGYFSSNNRTSLLYVTTAPSSVLNTGKAYIF 272
            .|::...:         |:|     .:|:||:::.|.||.:|...  :|:..|.:....|...|:
 Frog   218 KYSITYENQLATRPASLSYD-----DSYLGYSVTVGDFSGDNIED--FVSGVPRAAKTLGMVSIY 275

  Fly   273 DVVGEIVRKLHVFHGEQLGEYFGYSVVAEDLNGDGLTDVVVSAPL----NALGDSYDVGAIYVFI 333
            |  |:.:..|:.|.|||:..||||||...|:|||||.|:.:.|||    .:.|...::|.:.|::
 Frog   276 D--GKTMTSLYNFTGEQMAAYFGYSVATSDINGDGLVDLFIGAPLFMDRGSDGKLQELGQVSVYL 338

  Fly   334 NKGLFKFEKKIIRLPLSSG----ARFGSSLSKVGDINHDGYNDLAVGAPFAG---NGAVFIFLGS 391
            .... ...:.:|:|   :|    |||.|.:..:|||:.||:||||:.||:.|   .|.|:|:.|.
 Frog   339 QHST-NGPQHLIKL---TGFEIFARFSSCIGPLGDIDGDGFNDLAIAAPYGGVNKKGLVYIYNGR 399

  Fly   392 EHGLRDEPSQRLDAPSREPGPYGA-HM---FGQGLSRGSDIDGNGFNDLAIGAPGAEAVYLYRAY 452
            .:|:...|||.|:      |.:.: ||   ||..|...:|:|.||:.||.:||.||:...||||.
 Frog   400 PNGMSIVPSQILE------GQWASQHMPSSFGYSLKGATDVDENGYPDLLVGAFGADKAILYRAR 458

  Fly   453 PVVKIHATVRSESRAIRPEQETITV-----TACYRLETTSKA--RQMQQQELTFRMTI--DE--- 505
            ||:.:.:.:......:.||.:|.::     .:|:.::...||  :....|:|.||:.:  |:   
 Frog   459 PVITVTSLLEVNPTILNPESKTCSLPSGSKVSCFYVKFCLKAVGKGRVPQDLPFRVDVMLDKHKQ 523

  Fly   506 --LLQRVSFAPMR--TNEVSFQAQAGLSGSCRNFSVGVHYTGGI---FTPIDLELHYELAKKIPH 563
              .::|..|...|  ::..:...|.|....|......:......   .|||.:.:.:::      
 Frog   524 KGAIRRALFLHTRLSSHSKNMTIQNGSGMRCEELQAFLRDDSEFRDKLTPITIFMEFQM------ 582

  Fly   564 SHEAFCESCA---VVDPLEPKYATGTLSFMTGCAA-HVCVSDLQLSSKDVNSSFIFGSLEVLSFS 624
            .:::..:|..   :::...|...|.....:..|.. ::|...|:||.:........|....|:..
 Frog   583 DYKSTADSSGLLPILNQFTPTNITKQAHILLDCGEDNICKPSLKLSVESEQKKIFIGDDSPLTLI 647

  Fly   625 YEITNSGEPAYVAQFNVTSSARLPFAKVPGN--------CRVRHE----VMLCDLNGGRALARGD 677
            ....|.||.||.|:..|.......|..|..|        |..:.|    :::|||  |..:..|.
 Frog   648 VNAQNQGEGAYEAELVVQMPPETDFIGVIRNNETFSRLSCAFKTENKTHLVVCDL--GNPMKAGT 710

  Fly   678 SESLTIIFDVTQLS--GQSLTIEAAVSSAGMDQNPKDNTMSTTISLREYAEIDASGGPIDGHIAL 740
            .....::|.|.||:  ..|:..:..:.|:...:| .....|..|:|...|.::..|......:.|
 Frog   711 QIKAALLFSVHQLTEMDNSVKFDLQIQSSNQYEN-SSTVQSIEIALAVLAAVEVRGVSTPNEVFL 774

  Fly   741 -------KEYPYSAE-----VNNSYEFKSHGPSIIDELTVYVDVP-----------IAYTVTGSA 782
                   |..|.:.|     |.:.:|.:::|||...:..:.:..|           :.|.:.|  
 Frog   775 PIANWEQKMNPETEEDIGPLVQHIFELRNNGPSGFSKAILNLQWPYRYNNDTLLYIVKYEIDG-- 837

  Fly   783 GIKSIFNISSLQMQATHGSELVPIKL---YDQTNTLAKEYPLEDSSRRANRKRRELQQDQYAIMP 844
                       .|..|...|:.|:.:   ..|:|        |.:..|....|:..::|..|:..
 Frog   838 -----------PMNCTSDVEINPLNVKISASQSN--------EKNESRVPDNRQRNRRDLTAMNG 883

  Fly   845 DVNI-----SDILTKE----NLPANRTLVLDCLRGNWTICV----RSQMRVQLKPEQPID-LRIS 895
            .:..     :|.|..|    .|...::.:|......||:..    .......||...... |...
 Frog   884 HLQTLGCGQADCLKIECHVGRLDKGKSAILYVRSRLWTLTFLKNGNQNHSYSLKSSASFSVLEFP 948

  Fly   896 FK-VDLNDFVNTFDYLVIFTNVEMFKEGDSTSIALKRNLKPNVIFNYSETPLPIWYIILSLIAGH 959
            :| :.:.|..|:   .|:.||:....:..|                   .|:|:|.|||::::|.
 Frog   949 YKNIHIPDIQNS---TVVTTNILWVNQAAS-------------------LPVPVWVIILAVLSGL 991

  Fly   960 LLLGAMTYILYKLRFFKRGKKEELKRLLEEHRSETKEPATDCEG 1003
            |||..|.:|:|||.||||.:..:     ||...|..:|..:.||
 Frog   992 LLLSLMVFIMYKLGFFKRVRPPQ-----EEAEREQLQPQENGEG 1030

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ItgaPS5NP_611808.2 VCBS 302..375 CDD:338792 28/80 (35%)
Int_alpha 351..403 CDD:214549 25/58 (43%)
Int_alpha 417..463 CDD:214549 20/48 (42%)
Integrin_alpha2 451..836 CDD:337057 83/447 (19%)
itgavXP_012825487.1 Int_alpha 36..>80 CDD:214549 16/45 (36%)
WD40 repeat 177..230 CDD:293791 12/53 (23%)
Int_alpha 237..>277 CDD:214549 13/48 (27%)
WD40 repeat 243..287 CDD:293791 12/47 (26%)
Int_alpha 291..344 CDD:214549 19/53 (36%)
WD40 repeat 296..352 CDD:293791 19/59 (32%)
Int_alpha 356..411 CDD:214549 24/54 (44%)
WD40 repeat 361..412 CDD:293791 21/50 (42%)
Int_alpha 420..466 CDD:214549 20/45 (44%)
Integrin_alpha2 457..900 CDD:369878 87/472 (18%)
Integrin_alpha 1003..1017 CDD:334029 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.