DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp4 and RRP40

DIOPT Version :9

Sequence 1:NP_001286771.1 Gene:Rrp4 / 37731 FlyBaseID:FBgn0034879 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_014499.2 Gene:RRP40 / 854023 SGDID:S000005502 Length:240 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:35/146 - (23%)
Similarity:57/146 - (39%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 RYVGEIGDVVVARVSEVQQKRWRVDTNSRLDSILLLSSVNLPGGELRRRSAEDEQMMRRYLDEGD 142
            ||:..:.|.|:..:.......::|...: ..|.:.||.:..|....:.|..         |..||
Yeast    63 RYIPSVNDFVIGVIIGTFSDSYKVSLQN-FSSSVSLSYMAFPNASKKNRPT---------LQVGD 117

  Fly   143 LISAEVQNIFEEGSL------SLYTRSLKYGKLSQGILVKVFPALVKRRKMHFHN----LPCGAS 197
            |:.|.|....:|...      |...|...:|.|..|:::.|  .|...|::.|:|    |...|:
Yeast   118 LVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDV--NLNFARQLLFNNDFPLLKVLAA 180

  Fly   198 -----VILGNNGYIWI 208
                 |.:|.||.||:
Yeast   181 HTKFEVAIGLNGKIWV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp4NP_001286771.1 Rrp4 27..>209 CDD:224022 35/146 (24%)
KH-I 172..290 CDD:412160 14/46 (30%)
RRP40NP_014499.2 Rrp4 1..240 CDD:224022 35/146 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.