DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp4 and Exosc3

DIOPT Version :9

Sequence 1:NP_001286771.1 Gene:Rrp4 / 37731 FlyBaseID:FBgn0034879 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_079789.1 Gene:Exosc3 / 66362 MGIID:1913612 Length:274 Species:Mus musculus


Alignment Length:263 Identity:58/263 - (22%)
Similarity:91/263 - (34%) Gaps:91/263 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QPR---VYTPG------EVLMPEAGFMR-------GHGTFVEDENIKSSVAGVIQKVNKLISVRP 74
            :||   |..||      .:|:.:.|.:|       |.|.:..|...|..|              |
Mouse    60 RPRLRVVCGPGLRRCGDRLLVTKCGRLRHKEPSGGGGGVYWVDSQQKRYV--------------P 110

  Fly    75 LKSRYVGEIGDVVVARVSEVQQKRWRVDTNSRLDSILLLSSVNLPGGELRRRSAEDEQMMRRYLD 139
            :|..:|  || :|:|:..::    ::||...  .....||.:...|...|.|.         .:.
Mouse   111 VKGDHV--IG-IVIAKSGDI----FKVDVGG--SEPASLSYLAFEGATKRNRP---------NVQ 157

  Fly   140 EGDLISAE--VQNIFEEGSLSLYT---RSLKYGKLSQ-GILVKVFPALVKR------------RK 186
            .||||..:  |.|...|..:....   |:...|.:.| |:|.||...|:::            .|
Mouse   158 VGDLIYGQCVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIVQELGK 222

  Fly   187 MHFHNLPCGASVILGNNGYIWISPTKGQEEEGGEGGFAQNL--------NEHVPRADR-EVIARL 242
            ::      ...::.|.||.||:.....|          |.|        .||:....| ::.|||
Mouse   223 LY------PLEIVFGMNGRIWVKAKTIQ----------QTLILANVLEACEHMTTEQRKQIFARL 271

  Fly   243 RNS 245
            ..|
Mouse   272 AES 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp4NP_001286771.1 Rrp4 27..>209 CDD:224022 48/215 (22%)
KH-I 172..290 CDD:412160 21/95 (22%)
Exosc3NP_079789.1 S1_Rrp40 107..192 CDD:240216 24/116 (21%)
KH_6 196..242 CDD:292607 11/51 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.