DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp4 and exosc2

DIOPT Version :9

Sequence 1:NP_001286771.1 Gene:Rrp4 / 37731 FlyBaseID:FBgn0034879 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001025658.1 Gene:exosc2 / 595050 XenbaseID:XB-GENE-977773 Length:293 Species:Xenopus tropicalis


Alignment Length:268 Identity:170/268 - (63%)
Similarity:215/268 - (80%) Gaps:4/268 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TPGEVLMPEAGFMRGHGTFVEDENIKSSVAGVIQKVNKLISVRPLKSRYVGEIGDVVVARVSEVQ 95
            |||:.:..:.||||||||:.||:.:.:|||||:::|||||.||.||:||.||:||:||.|::|||
 Frog    28 TPGDTITTDTGFMRGHGTYTEDDKLVASVAGVVERVNKLICVRALKARYNGEVGDIVVGRITEVQ 92

  Fly    96 QKRWRVDTNSRLDSILLLSSVNLPGGELRRRSAEDEQMMRRYLDEGDLISAEVQNIFEEGSLSLY 160
            ||||:|||||||||:|:||:|||||||||||||:||..||.||.||||||||||.::.:|:|||:
 Frog    93 QKRWKVDTNSRLDSVLILSAVNLPGGELRRRSAKDELAMRDYLQEGDLISAEVQAVYSDGALSLH 157

  Fly   161 TRSLKYGKLSQGILVKVFPALVKRRKMHFHNLPCGASVILGNNGYIWISPT-KGQEEEGGEGGFA 224
            |||||||||.||:||:|.|:|:||||.||||||||||:||.|||:||:..| |..|||.  |||.
 Frog   158 TRSLKYGKLGQGVLVRVSPSLIKRRKTHFHNLPCGASIILANNGFIWLCATPKEMEEEA--GGFI 220

  Fly   225 QNLNEHVPRADREVIARLRNSILALAKCKLMIYDTSIQYAYEESLRYEAHELLQQNAIYDIGQQT 289
            .|| |.|..:|||||:||||.|||||..|:::||||:.|.||.||.::..|||:...|.||..:|
 Frog   221 TNL-EPVALSDREVISRLRNCILALASQKMLLYDTSVLYCYEASLAHQIKELLKVEVIEDIVMET 284

  Fly   290 QARLRDAD 297
            :.||.:.:
 Frog   285 RQRLLEQE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp4NP_001286771.1 Rrp4 27..>209 CDD:224022 125/177 (71%)
KH-I 172..290 CDD:412160 69/118 (58%)
exosc2NP_001025658.1 Rrp4 26..248 CDD:224022 151/222 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3928
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6095
Inparanoid 1 1.050 341 1.000 Inparanoid score I2301
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1121868at2759
OrthoFinder 1 1.000 - - FOG0004841
OrthoInspector 1 1.000 - - oto102575
Panther 1 1.100 - - LDO PTHR21321
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1222
SonicParanoid 1 1.000 - - X3419
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.