DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp4 and exos-3

DIOPT Version :9

Sequence 1:NP_001286771.1 Gene:Rrp4 / 37731 FlyBaseID:FBgn0034879 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_492751.1 Gene:exos-3 / 186604 WormBaseID:WBGene00010325 Length:226 Species:Caenorhabditis elegans


Alignment Length:208 Identity:47/208 - (22%)
Similarity:83/208 - (39%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VYTPGEVLMPEA---GFMRGHGTFVEDENIKSSVAGVIQKVNKLISVRPLKSRYVGEIGDVVVAR 90
            ||.||:|:...:   ..:.|:|..|..:...::..|.....:..:.:.....||:.:.||.|:|.
 Worm     3 VYLPGDVINEPSSSDSSIIGYGISVRGQTRIATQPGAFHNDDGKVWLNVHSKRYIPQEGDRVIAI 67

  Fly    91 VSEVQQKRWRVDTNSRLDSILLLSSVNLPGGELRRRSAEDEQMMRRYLDEGDLISAEVQNIFE-- 153
            |:......:|:|..:.  ...:::..|..|...|.|.         .|..||:|.|   .:|:  
 Worm    68 VTSKTGDFFRLDIGTA--EYAMINFTNFEGATKRNRP---------NLKTGDIIYA---TVFDTT 118

  Fly   154 ---EGSLSLY---TRSLKYGKLSQGILVKVFPALVKRRKMHFHNLPCGA----------SVILGN 202
               |..|:..   .|:...|:|:.|.:.||  :|...|::  .|..|..          .:.:|.
 Worm   119 PRTEAELTCVDDEKRARGMGQLNGGFMFKV--SLNHCRRL--INPSCKILQTVGKFFKFEITVGM 179

  Fly   203 NGYIWISPTKGQE 215
            ||.||||.:...:
 Worm   180 NGRIWISASTSDD 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp4NP_001286771.1 Rrp4 27..>209 CDD:224022 45/200 (23%)
KH-I 172..290 CDD:412160 14/54 (26%)
exos-3NP_492751.1 Rrp4 5..>187 CDD:224022 44/199 (22%)
S1_Rrp40 55..140 CDD:240216 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.