DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp4 and exos-2

DIOPT Version :9

Sequence 1:NP_001286771.1 Gene:Rrp4 / 37731 FlyBaseID:FBgn0034879 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_500978.1 Gene:exos-2 / 177403 WormBaseID:WBGene00022232 Length:303 Species:Caenorhabditis elegans


Alignment Length:276 Identity:122/276 - (44%)
Similarity:173/276 - (62%) Gaps:14/276 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EQPRVYTPGEVL--MPEAGFMRGHGTFVEDENIKSSVAGVIQKVNKLISVRPLKSRYVGEIGDVV 87
            ::.::..||..:  .|:. |||||||:|.|..|.||::||:|::|:|:.|:.:|.||.||:||||
 Worm    27 DETKIVIPGHSVCDAPQQ-FMRGHGTYVRDGEIVSSLSGVVQQLNRLLMVKTIKQRYAGEVGDVV 90

  Fly    88 VARVSEVQQKRWRVDTNSRLDSILLLSSVNLPGGELRRRSAEDEQMMRRYLDEGDLISAEVQNIF 152
            ||||.|||.|||:.|..|||.:.|.|.||.||||:.||:..|||:.|..:|..|:||.||||.:.
 Worm    91 VARVVEVQAKRWKCDVASRLHANLPLGSVLLPGGDFRRKDVEDEEKMSEFLKNGELICAEVQQVQ 155

  Fly   153 EEGSLSLYTRSLKYGKLSQGILVKVFPALVKRRKMHFHNLPCGASVILGNNGYIWISPTKGQ--- 214
            .:|:|.|:||:.|||||.||||:||.|.|:|:.|.|||.||.|.:||:|.||.:|::|:..:   
 Worm   156 HDGTLMLHTRNNKYGKLQQGILIKVPPHLIKKSKKHFHTLPYGMAVIIGCNGSVWVTPSLPETTL 220

  Fly   215 EEEGGEGGFAQNLNEH--VPRADREVIARLRNSILALAKCKLMIYDTSIQYAYEESLRYEAHELL 277
            ||:|      .:::|.  ||...|..:.|:...:..|....:.||..|:...||.|..||..||.
 Worm   221 EEDG------SHVHEFQIVPPDVRVTMVRIAACVRLLRDYSISIYLNSLTTCYEMSQPYEIKELA 279

  Fly   278 QQNAIYDIGQQTQARL 293
            :|:....:.....|||
 Worm   280 EQDTSSRLAYLIAARL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp4NP_001286771.1 Rrp4 27..>209 CDD:224022 98/183 (54%)
KH-I 172..290 CDD:412160 42/122 (34%)
exos-2NP_500978.1 ECR1_N 31..68 CDD:291080 17/37 (46%)
S1_Rrp4 81..172 CDD:240215 52/90 (58%)
KH_6 175..214 CDD:292607 21/38 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162240
Domainoid 1 1.000 121 1.000 Domainoid score I3552
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6095
Inparanoid 1 1.050 221 1.000 Inparanoid score I2285
Isobase 1 0.950 - 0 Normalized mean entropy S934
OMA 1 1.010 - - QHG54120
OrthoDB 1 1.010 - - D1121868at2759
OrthoFinder 1 1.000 - - FOG0004841
OrthoInspector 1 1.000 - - oto19532
orthoMCL 1 0.900 - - OOG6_101400
Panther 1 1.100 - - LDO PTHR21321
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1222
SonicParanoid 1 1.000 - - X3419
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.