DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pita and DOT5

DIOPT Version :9

Sequence 1:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_172787.1 Gene:DOT5 / 837889 AraportID:AT1G13290 Length:302 Species:Arabidopsis thaliana


Alignment Length:243 Identity:49/243 - (20%)
Similarity:73/243 - (30%) Gaps:98/243 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 FQCGVCTKSFAFKQGLERHETVH-----------------STNLPFPCQHCE------------- 432
            |.|.||.|:|.....::.|...|                 |:.|..||..|.             
plant   101 FSCSVCNKTFNRFNNMQMHMWGHGSQYRKGPESLRGTKSSSSILRLPCYCCAEGCKNNIDHPRSK 165

  Fly   433 --RSFSTASKLARHLVAHAGKRAYPC-KYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYS 494
              :.|.|   |..|.....|.:.:.| |.|.|::.    :....|||.:.....:.| .|...:.
plant   166 PLKDFRT---LQTHYKRKHGAKPFRCRKKCEKTFA----VRGDWRTHEKNCGKLWFC-VCGSDFK 222

  Fly   495 NYNDLLDHALIHATASLKCPMCRKQIEDIDSVESHMDQHKQSERHACEFCDHIFLTQKCLQRHIE 559
            :...|.||                       |.:..|.|                     ..|..
plant   223 HKRSLKDH-----------------------VRAFGDGH---------------------AAHTV 243

  Fly   560 DDHVVEMEPYQNEFEDDGEGEGGVDEKEEHLDDFEDMD----NVKQEE 603
            .|.||.:    .:.::|.|     :|:||..||.|:.|    ||:.|:
plant   244 SDRVVGI----GDADEDDE-----EEEEEEEDDVEEEDAHEENVRGEK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 30/140 (21%)
C2H2 Zn finger 288..308 CDD:275368
C2H2 Zn finger 316..336 CDD:275368
zf-H2C2_2 328..353 CDD:290200
C2H2 Zn finger 344..364 CDD:275368
C2H2 Zn finger 372..388 CDD:275370
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 428..448 CDD:275368 6/34 (18%)
C2H2 Zn finger 456..476 CDD:275368 5/20 (25%)
C2H2 Zn finger 486..506 CDD:275368 5/19 (26%)
HARE-HTH <566..625 CDD:294801 12/42 (29%)
DOT5NP_172787.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.