DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pita and CG17801

DIOPT Version :9

Sequence 1:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster


Alignment Length:455 Identity:109/455 - (23%)
Similarity:164/455 - (36%) Gaps:111/455 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CRFCLTEQKLASIF-EENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRFKQ 81
            |..|      ||.| ..||.:.....:..:|..:|.|.:...:..|.|||..|........:.|:
  Fly    10 CHLC------ASCFCHLNPTIIFCLEVLAKIKDLTGIWLEQNERQPRHICPSCLNDLNTSIKLKK 68

  Fly    82 MCKRAE---TLLRQYPLTGNWPSPLE--KPRAPMTMVASKKLLVVP----AKTAEPSETPKKLLN 137
            ..:|..   ||.|:..|..:..|.:.  :|....:.:.|::.....    .|.||.|:....|.:
  Fly    69 RIQRVHNEATLRRESGLDEDLESTVSDIEPEGDSSDLESEESYDSENYPFDKKAEESDIDLNLAH 133

  Fly   138 TMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLE--DMA 200
                       ||                     ||:..:. ..|:...|.......::|  ..|
  Fly   134 -----------ED---------------------RRNEPHN-PYDSETPLIFKHKNPLIETPSFA 165

  Fly   201 SELEKEFPDIPQKASPVKPKVLN----KSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEV 261
            :|      ::|.|.....||..|    .:.:|:|...|:..|...||                 :
  Fly   166 NE------NLPNKVDAKSPKKGNFIQIGTDLRLLTTYPSIKVVKPLA-----------------L 207

  Fly   262 LDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSK 326
            ...|:..::.....:.|.|:.:.|  ||.|.|.|.....|:.|.:.||..::|.|..|:|.|.:|
  Fly   208 APEDVAAENVPPAKRTARKMQSLV--CPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTK 270

  Fly   327 YDLAKHNFV-HTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAE 390
            |....|..| |.||:||:|..||..|........|||.                           
  Fly   271 YLARLHERVRHMGEQPFECNFCSATFFTSTAKSSHERI--------------------------- 308

  Fly   391 RHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHL--VAHAGKRA 453
            ||.:...:||..|||.|..|..|.:|:.:||...||.|..|:.:|:..:.|..|.  |||. |||
  Fly   309 RHIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSHFDSVAHQ-KRA 372

  Fly   454  453
              Fly   373  372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 19/77 (25%)
COG5048 <281..506 CDD:227381 57/176 (32%)
C2H2 Zn finger 288..308 CDD:275368 7/19 (37%)
C2H2 Zn finger 316..336 CDD:275368 8/20 (40%)
zf-H2C2_2 328..353 CDD:290200 11/25 (44%)
C2H2 Zn finger 344..364 CDD:275368 7/19 (37%)
C2H2 Zn finger 372..388 CDD:275370 0/15 (0%)
C2H2 Zn finger 400..420 CDD:275368 8/19 (42%)
C2H2 Zn finger 428..448 CDD:275368 6/21 (29%)
C2H2 Zn finger 456..476 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 17/69 (25%)
zf-C2H2 231..252 CDD:278523 8/22 (36%)
C2H2 Zn finger 232..252 CDD:275368 7/19 (37%)
zf-H2C2_2 244..269 CDD:290200 9/24 (38%)
C2H2 Zn finger 260..281 CDD:275368 8/20 (40%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
C2H2 Zn finger 346..362 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.