DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pita and CG17806

DIOPT Version :9

Sequence 1:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:482 Identity:106/482 - (21%)
Similarity:176/482 - (36%) Gaps:115/482 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VCRFCLTEQKLA-SIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRFK 80
            :||.|..|.:.| |:|::..|     ::...|:.:|...:....|:|..|||.|.|.......|:
  Fly     4 LCRTCGQEAEHAKSLFDKEAR-----DVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFR 63

  Fly    81 QMCKRAETLLRQYPLTGNW--------PSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLN 137
            :.|.|..:         :|        .|..|..|.........::.|:|...|:|..  :::|.
  Fly    64 ERCIRTNS---------SWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQR--RRILP 117

  Fly   138 TMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMD-DVQSM-LEDMA 200
            ..:|....|.::.|:.....:|.|.........|.|... .::|.:..:||.| .|:|| .|:.|
  Fly   118 QRSKKVDGVPLKTVETPIYPLVVPEIPPADLVDPLRCED-PIQVKSEPQLSSDYPVESMNHEEPA 181

  Fly   201 SELEKEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSD 265
            ||:.:...:.|:             :::::.:     |:.....|:.|       ..:.|....|
  Fly   182 SEMPQVMKEEPR-------------TLQVIGE-----VQKNRRKPRSK-------GCLEECPGKD 221

  Fly   266 LPLDDQDDPTKN---AEKVAT---------------DVFPCPDCERSFPLQQLLEIHRLNHTRSR 312
            :...:..|.|.|   .||.||               .::.|..|.::|..:....:|...|..::
  Fly   222 MAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTK 286

  Fly   313 SFQCLLCEKSFFSKYDLAKH-NFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCE 376
            .|||..|::..|:::.|..| ...|.||.|:.|..|.|.|........|||.|.:.|        
  Fly   287 EFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESP-------- 343

  Fly   377 KPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKL 441
                             ..||..|..|.|:|.....|:.|..||:...||.|:.|:..|:..:.|
  Fly   344 -----------------VHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNAL 391

  Fly   442 ARHLVAHAGKRAYPCKYCHKSYMLSHH 468
            |.|                  |...||
  Fly   392 ATH------------------YKSKHH 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 20/75 (27%)
COG5048 <281..506 CDD:227381 48/204 (24%)
C2H2 Zn finger 288..308 CDD:275368 4/19 (21%)
C2H2 Zn finger 316..336 CDD:275368 5/20 (25%)
zf-H2C2_2 328..353 CDD:290200 10/25 (40%)
C2H2 Zn finger 344..364 CDD:275368 7/19 (37%)
C2H2 Zn finger 372..388 CDD:275370 0/15 (0%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 428..448 CDD:275368 6/19 (32%)
C2H2 Zn finger 456..476 CDD:275368 3/13 (23%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 21/85 (25%)
zf-C2H2 260..282 CDD:278523 4/21 (19%)
C2H2 Zn finger 262..282 CDD:275368 4/19 (21%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
COG5048 <298..>383 CDD:227381 30/109 (28%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 11/44 (25%)
C2H2 Zn finger 378..396 CDD:275368 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.