DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pita and ouib

DIOPT Version :9

Sequence 1:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:473 Identity:98/473 - (20%)
Similarity:151/473 - (31%) Gaps:183/473 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VCRFCLTE---QKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYR 78
            |||.|..:   :|..::|:...| |...:|.:    |:.:.:...|.:||.:||.|:........
  Fly     5 VCRVCGRQKICEKSLNLFDLVNR-KYLKHLHM----ISGLRLVDLDDVPGFMCLCCQAELRSALA 64

  Fly    79 FKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTMAKSS 143
            |:::|.:.:|         .|                                            
  Fly    65 FRKLCIKTQT---------KW-------------------------------------------- 76

  Fly   144 SQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLEDM--ASELEKE 206
              :.||                                        ||..|..||.  .||||.|
  Fly    77 --LTIE----------------------------------------DDSSSGDEDTNDNSELESE 99

  Fly   207 ---FPDIPQKASPVKPKVLNKSSIRIL-NKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDLP 267
               |.|..:|    |...|.:.:.::| .:.|......|.|..:::.|.                
  Fly   100 KCAFSDFGKK----KEGELVEETFQVLIEEEPMDKTLNRDAKAQLREDG---------------- 144

  Fly   268 LDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKH 332
            :|::..|::...||:|.:                        ..:.:.|.||.....||....:|
  Fly   145 IDEKCVPSQKIIKVSTKL------------------------DDQIYICELCGTHATSKPTFQRH 185

  Fly   333 NFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRP 397
            ...|.|||||.|..|...|.....|..|.|.||....|.|.:|||.::|                
  Fly   186 MRKHRGERPFGCKDCDARFLSAGELRAHHRVHTGEQPFACRFCEKRYVS---------------- 234

  Fly   398 FQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKS 462
                        ..|...||..|:.:.|:.|:.|.:.|:||..|..|:|.|.|:|.:.|..|.:|
  Fly   235 ------------YMGRLIHERTHTNDRPYVCEECGKKFTTAYVLKNHMVIHTGERNFRCDICDRS 287

  Fly   463 YMLSHHLSRHLRT--HTQ 478
            :....||..|.|:  |.|
  Fly   288 FQRKAHLVTHTRSMMHLQ 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 19/77 (25%)
COG5048 <281..506 CDD:227381 53/200 (27%)
C2H2 Zn finger 288..308 CDD:275368 0/19 (0%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 10/24 (42%)
C2H2 Zn finger 344..364 CDD:275368 6/19 (32%)
C2H2 Zn finger 372..388 CDD:275370 5/15 (33%)
C2H2 Zn finger 400..420 CDD:275368 3/19 (16%)
C2H2 Zn finger 428..448 CDD:275368 8/19 (42%)
C2H2 Zn finger 456..476 CDD:275368 7/21 (33%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
ouibNP_649822.2 zf-AD 5..78 CDD:214871 20/132 (15%)
COG5048 <158..300 CDD:227381 50/193 (26%)
C2H2 Zn finger 169..189 CDD:275368 6/19 (32%)
C2H2 Zn finger 197..217 CDD:275368 6/19 (32%)
zf-H2C2_2 209..234 CDD:290200 10/24 (42%)
C2H2 Zn finger 225..245 CDD:275368 8/47 (17%)
zf-H2C2_2 241..262 CDD:290200 7/20 (35%)
C2H2 Zn finger 253..273 CDD:275368 8/19 (42%)
zf-H2C2_2 266..288 CDD:290200 8/21 (38%)
C2H2 Zn finger 281..299 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.