DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pita and nom

DIOPT Version :9

Sequence 1:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:520 Identity:111/520 - (21%)
Similarity:178/520 - (34%) Gaps:165/520 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VCRFCLTEQ---KLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYR 78
            |||.|...:   |...:|:...:     ::..:|..||.|.:......|..:|..|:...:....
  Fly     5 VCRVCGRSRLCPKAVELFKPGRQ-----DILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMI 64

  Fly    79 FKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSE-TPKKLLNTMAKS 142
            |::.|     :|:|    ..|          :.::.|.|:.....|..||:: :.||......:.
  Fly    65 FRRQC-----ILQQ----KKW----------VPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRG 110

  Fly   143 SSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLEDMASELEKEF 207
            ..::.:|.|.:    :||                .|.|....:.:..|:.     |...|:..| 
  Fly   111 RPRMPLEIVDI----VVT----------------NESKASAGESVGGDEF-----DQPVEISNE- 149

  Fly   208 PDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDLPLDDQD 272
            ||                                 ||                  |||:.|::.|
  Fly   150 PD---------------------------------AT------------------DSDVNLEEID 163

  Fly   273 DPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHT 337
            .|.::..:...|:   |:          ::||:          |..|.....:|..|.:|.|.|.
  Fly   164 LPDEDGLESDHDL---PN----------VQIHK----------CDTCGIIKNNKSSLVRHQFEHN 205

  Fly   338 GERPFKCAICSKAFTRKALLHRHERT-HTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCG 401
            |.||:.|..|.|.|...:.|..|..| ||..|.|.|.||::.:.|                    
  Fly   206 GIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFS-------------------- 250

  Fly   402 VCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLS 466
                    ..|.::||.||:...||.|..|.::|:....|..|:..|...|.|.|..|.:|:.|.
  Fly   251 --------VVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLK 307

  Fly   467 HHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESHMD 531
            .||:.|..::|...:|     |...|.|.|..:|... ...|.|...|:.....||:  |:|..|
  Fly   308 KHLATHFISNTHKRNA-----EAVTSSSEYMSMLSFE-SDETWSQGTPLTTSIDEDL--VQSQFD 364

  Fly   532  531
              Fly   365  364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 16/77 (21%)
COG5048 <281..506 CDD:227381 58/225 (26%)
C2H2 Zn finger 288..308 CDD:275368 3/19 (16%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 11/24 (46%)
C2H2 Zn finger 344..364 CDD:275368 7/20 (35%)
C2H2 Zn finger 372..388 CDD:275370 4/15 (27%)
C2H2 Zn finger 400..420 CDD:275368 3/19 (16%)
C2H2 Zn finger 428..448 CDD:275368 5/19 (26%)
C2H2 Zn finger 456..476 CDD:275368 7/19 (37%)
C2H2 Zn finger 486..506 CDD:275368 5/19 (26%)
HARE-HTH <566..625 CDD:294801
nomNP_001262384.1 zf-AD 5..76 CDD:214871 17/84 (20%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..261 CDD:275368 18/76 (24%)
zf-H2C2_2 255..278 CDD:290200 9/22 (41%)
C2H2 Zn finger 269..289 CDD:275368 5/19 (26%)
zf-H2C2_2 282..305 CDD:290200 8/22 (36%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.