DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pita and Zif

DIOPT Version :9

Sequence 1:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:477 Identity:94/477 - (19%)
Similarity:170/477 - (35%) Gaps:145/477 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RVCRFCLTE----QKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHC 76
            :.||.||.:    |:|..|.||..  ::...:.:|::.::...:...:.:|..||..|::.....
  Fly     8 QTCRVCLAQSERLQRLDEIREEGE--ESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMA 70

  Fly    77 YRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTMAK 141
            |:|::...|.:..:.:|             ...:.::....::::..:                .
  Fly    71 YQFREKALRKQMEIEEY-------------CRELGLLDESDVMMIKEE----------------D 106

  Fly   142 SSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVD-NNQELSMDDVQSMLED------- 198
            .|.|...|::.:||..     |.........:.|...|:|| ::|:..:.|....|||       
  Fly   107 GSQQQCDEEMYILEET-----TTGEEEHQEEKGHEEYLEVDTSDQQECIGDTIEYLEDNYTIEMN 166

  Fly   199 -----MASELEKEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIV 258
                 :..|.||::.:.|.:...::                    |...|:.|.:|      ..|
  Fly   167 SDQTEIVLESEKQYEETPSQQLALQ--------------------EAAKASLKARR------GRV 205

  Fly   259 TEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSF 323
            ...|:|   |...|...|..       :.|..|...:..:..:..||..|.....:.|.||:..|
  Fly   206 RRGLNS---LTTSDGTEKGG-------YICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKF 260

  Fly   324 FSKYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKH 388
            ..:..|.||.:.|||.:|:||:.||:.|..:::|..||..|..:                     
  Fly   261 QVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGI--------------------- 304

  Fly   389 AERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRA 453
                   :|:.|.||.|:||:...|.:||.:||                            ..:.
  Fly   305 -------KPYVCKVCDKAFAYAHSLTKHELIHS----------------------------DIKL 334

  Fly   454 YPCKYCHKSYMLSHHLSRHLRT 475
            |.|.||:|.:.|.||:.:|..|
  Fly   335 YRCDYCNKDFRLLHHMRQHEET 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 17/78 (22%)
COG5048 <281..506 CDD:227381 47/195 (24%)
C2H2 Zn finger 288..308 CDD:275368 4/19 (21%)
C2H2 Zn finger 316..336 CDD:275368 7/19 (37%)
zf-H2C2_2 328..353 CDD:290200 12/24 (50%)
C2H2 Zn finger 344..364 CDD:275368 7/19 (37%)
C2H2 Zn finger 372..388 CDD:275370 0/15 (0%)
C2H2 Zn finger 400..420 CDD:275368 9/19 (47%)
C2H2 Zn finger 428..448 CDD:275368 0/19 (0%)
C2H2 Zn finger 456..476 CDD:275368 9/20 (45%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 17/79 (22%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
COG5048 <250..369 CDD:227381 42/163 (26%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 266..288 CDD:290200 11/21 (52%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 294..318 CDD:290200 10/51 (20%)
C2H2 Zn finger 309..329 CDD:275368 9/19 (47%)
C2H2 Zn finger 337..353 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.