DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pita and CG17385

DIOPT Version :10

Sequence 1:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_610962.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster


Alignment Length:253 Identity:74/253 - (29%)
Similarity:111/253 - (43%) Gaps:33/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 NHTRSRSFQCLLCEKSFFSKYDLAKH-NFVHT-GERPFKCAICSKAFTRKALLHRHERTHTDVPK 369
            :.|.:..|.|..|:::|.||.|...| ..||. .:..::|.:|:|:|.....|.||.:.|.||..
  Fly     9 DETVANQFSCKRCDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMKVHNDVRP 73

  Fly   370 FICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERS 434
            |:|..|.|.|.....:::|...|..:|||.|..|.|||..:..::||:..|:...||.||.|.|.
  Fly    74 FVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGRY 138

  Fly   435 FSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDL 499
            ||....|.:|.:.|...:.|.|.||.|.:....:..|||::|.:..                .|:
  Fly   139 FSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEG----------------VDV 187

  Fly   500 LDHALIHATASL--------------KCPMCRKQIEDIDSVESHMDQ-HKQSERHACE 542
            ...|.|.|.|:|              :|.:||...:.....|.|..: |:..||...|
  Fly   188 DVPASIQAAAALARERLESEQKPSFFECMVCRAIFDTFADYEKHEAKCHEDHERAQLE 245

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 61/200 (31%)