DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and CASP10

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_116759.2 Gene:CASP10 / 843 HGNCID:1500 Length:522 Species:Homo sapiens


Alignment Length:299 Identity:104/299 - (34%)
Similarity:152/299 - (50%) Gaps:48/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GIRSPNGSENRGSFIMADNTDAKGCTPESLVVGGATAASPLPANKFVARMPVERYASEYNMSHKH 77
            |.|:.||:                   .|||..|...||   ||...:....:| |:.|.|:..|
Human   241 GNRATNGA-------------------PSLVSRGMQGAS---ANTLNSETSTKR-AAVYRMNRNH 282

  Fly    78 RGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKD---CKLRDILKHVGKAAEL 139
            ||:.:|.|:..|  .|||.|.||:.||:.|...|:.|||.|.:|.:   .::..:|:.  :....
Human   283 RGLCVIVNNHSF--TSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQK--QKCNP 343

  Fly   140 DHTDNDCLAVAILSHGEHGYLYAKD-TQYKLDNIWHYFTATFCPSLAGKPKLFFIQACQGDRLDG 203
            .|.|.||....||:||..|.:|:.| ....:..|..:|||..||.||.||||||||||||:.:..
Human   344 AHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQP 408

  Fly   204 GITLEKGVTETDGESSTSYK--IPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKK 266
            .:::|......: ::.||.:  ||..||||...:|:|||.|:|::..||||:|||...|.....:
Human   409 SVSIEADALNPE-QAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPR 472

  Fly   267 Y-DLLTLLTFVNQRVALDFESNVPATPMMDRQ---KQIP 301
            : |:|::||.||..|          :..:|:|   ||:|
Human   473 HEDILSILTAVNDDV----------SRRVDKQGTKKQMP 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 90/241 (37%)
CASP10NP_116759.2 DD 18..99 CDD:326335
DED_Caspase_10_r2 112..190 CDD:260074
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..269 12/49 (24%)
CASc 276..514 CDD:214521 90/241 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.