DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and CASP8

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001073594.1 Gene:CASP8 / 841 HGNCID:1509 Length:538 Species:Homo sapiens


Alignment Length:264 Identity:102/264 - (38%)
Similarity:136/264 - (51%) Gaps:34/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 YNMSHKHRGVALIFNHEFF-----DIP---SLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLR 127
            |.|..|.||..||.|:..|     .:|   |::.|.||::||..|...||.|.|.:..|.||.:.
Human   285 YQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVE 349

  Fly   128 DILKHVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQ----YKLDNIWHYFTATFCPSLAGKP 188
            .|.:.:.....:||::.||....|||||:.|.:|..|.|    |:|.:   .||...||||||||
Human   350 QIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTS---QFTGLKCPSLAGKP 411

  Fly   189 KLFFIQACQGDRLDGGITL-----EKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINN 248
            |:|||||||||....||.:     |:...|.|..|..:..||..||||...:|:....|:||...
Human   412 KVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAE 476

  Fly   249 GSWYMQSL---IRELNANGKKYDLLTLLTFVNQRVA-LDFESNVPATPMMDRQKQIPCLTSMLTR 309
            |:||:|||   :||....|.  |:||:||.||..|: .|.:.|:        .||:|..|..|.:
Human   477 GTWYIQSLCQSLRERCPRGD--DILTILTEVNYEVSNKDDKKNM--------GKQMPQPTFTLRK 531

  Fly   310 ILRF 313
            .|.|
Human   532 KLVF 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 101/262 (39%)
CASP8NP_001073594.1 DED_Caspase_8_r1 62..143 CDD:260041
DD 157..239 CDD:301326
CASc 284..536 CDD:237997 102/264 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.