DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcp-1 and CASP4

DIOPT Version :9

Sequence 1:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001216.1 Gene:CASP4 / 837 HGNCID:1505 Length:377 Species:Homo sapiens


Alignment Length:291 Identity:80/291 - (27%)
Similarity:125/291 - (42%) Gaps:38/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PESLVVGGATAASPLPANKFVARMPVERYASEYNMSHKH---RGVALIFNHEFFDIPSLKSRTGT 100
            |||   |.:|.|..|..::...|:..||....|.:..::   |...:|.|.||..:|   .|.|.
Human    97 PES---GESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLP---PRNGA 155

  Fly   101 NVDAQELKKAFENLGFAVSVHKDCKLRDILKHV-GKAAELDHTDNDCLAVAILSHG-EHGYLYAK 163
            :.|...:|:..|.|.::|.|.::...||:...: ..|...:|..:|...:.::||| ..|.....
Human   156 DFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTV 220

  Fly   164 DTQYK-----LDNIWHYFTATFCPSLAGKPKLFFIQACQGDR------LDGGITLEKGVTETDG- 216
            ..:.|     .|.|:..|....|.||..|||:..:|||:|..      .|...:||...:::.. 
Human   221 HDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSEN 285

  Fly   217 -ESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRV 280
             |....||..:..||:...|:.|...|||:...||.::..||...    :||.....|..|.::|
Human   286 LEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCF----QKYSWCCHLEEVFRKV 346

  Fly   281 ALDFESNVPATPMMDRQK-QIPCLTSM-LTR 309
            ...||     ||   |.| |:|.:..: :||
Human   347 QQSFE-----TP---RAKAQMPTIERLSMTR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 70/259 (27%)
CASP4NP_001216.1 Required for LPS-binding. /evidence=ECO:0000250|UniProtKB:P70343 1..59
CARD_CASP1-like 5..81 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 4/9 (44%)
CASc 126..375 CDD:214521 70/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.